Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CRYGS protein

This Human CRYGS protein spans the amino acid sequence from region 2-178aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Gamma-S-crystallin Gamma-crystallin S

UniProt

P22914

Expression Region

2-178aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-165AA: 1-178AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Icotinib Hydrochloride
MBS384408-01 5 mg

Icotinib Hydrochloride

Sign In for Pricing
View Details
Icotinib Hydrochloride
MBS384408-02 10 mg

Icotinib Hydrochloride

Sign In for Pricing
View Details
Icotinib Hydrochloride
MBS384408-03 25 mg

Icotinib Hydrochloride

Sign In for Pricing
View Details
Icotinib Hydrochloride
MBS384408-04 50 mg

Icotinib Hydrochloride

Sign In for Pricing
View Details
Icotinib Hydrochloride
MBS384408-05 5x 50 mg

Icotinib Hydrochloride

Sign In for Pricing
View Details
OCD1 Recombinant Protein (Human)
RP079116 100 µg

OCD1 Recombinant Protein (Human)

Sign In for Pricing
View Details