Human CRYGS protein
This Human CRYGS protein spans the amino acid sequence from region 2-178aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Gamma-S-crystallin Gamma-crystallin S
UniProt
P22914
Expression Region
2-178aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Neuroscience
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
47.9 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-165AA: 1-178AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
MBS6433307-01 0.1 mL
Protein Tyrosine Phosphatase Receptor Type R (PTPRR, PTPRQ, EC-PTP, PCPTP1, PTP-SL, PTPBR7) (Biotin)
Sign In for Pricing
View Details MBS6433307-02 5x 0.1 mL
Protein Tyrosine Phosphatase Receptor Type R (PTPRR, PTPRQ, EC-PTP, PCPTP1, PTP-SL, PTPBR7) (Biotin)
Sign In for Pricing
View Details 
GTR15217945 1 Vial
Lentiviral mouse Gm10413 shRNA (UAS) - Lentiviral mouse Gm10413 shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details GTR15113896 1 Vial
Lentiviral human RCSD1 shRNA (UAS) - Lentiviral human RCSD1 shRNA (UAS, iRFP) plasmid
Sign In for Pricing
View Details 
orb2913302-01 20 µg
Recombinant Escherichia coli Putative membrane protein igaA homolog (yrfF)
Sign In for Pricing
View Details orb2913302-02 100 µg
Recombinant Escherichia coli Putative membrane protein igaA homolog (yrfF)
Sign In for Pricing
View Details