Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human CHIC2 protein

This Human CHIC2 protein spans the amino acid sequence from region 1-165aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

BrX-like translocated in leukemia

UniProt

Q9UKJ5

Expression Region

1-165aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-258AA: 1-165AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADFDEIYEEEEDEERALEEQLLKYSPDPVVVRGSGHVTVFGLSNKFESEFPSSLTGKVAPEEFKASINRVNSCLKKNLPVNVRWLLCGCLCCCCTLGCSMWPVICLSKRTRRSIEKLLEWENNRLYHKLCLHWRLSKRKCETNNMMEYVILIEFLPKTPIFRPD

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carboxyl Fluorescent Particles, Nile Blue, Low Int., 0.5% w/v, 5.0-5.9 µm
CFL-5065-2 2 mL

Carboxyl Fluorescent Particles, Nile Blue, Low Int., 0.5% w/v, 5.0-5.9 µm

Sign In for Pricing
View Details
ZFP442 Double Nickase Plasmid (m)
sc-437152-NIC 20 µg

ZFP442 Double Nickase Plasmid (m)

Sign In for Pricing
View Details
CELLCOAT® bottle, TC, Collagen I coating, 650ml, 175cm2, polystyrene, red screw cap with filter, 40 pieces per CAR
661950 40 pieces per CAR

CELLCOAT® bottle, TC, Collagen I coating, 650ml, 175cm2, polystyrene, red screw cap with filter, 40 pieces per CAR

Sign In for Pricing
View Details
Porcine circovirus 2 antibody (PCV2 Ab) ELISA Kit
YP-W71232-01 48 Tests

Porcine circovirus 2 antibody (PCV2 Ab) ELISA Kit

Sign In for Pricing
View Details
Porcine circovirus 2 antibody (PCV2 Ab) ELISA Kit
YP-W71232-02 96 Tests

Porcine circovirus 2 antibody (PCV2 Ab) ELISA Kit

Sign In for Pricing
View Details
Mouse Matrix Metalloproteinase 13 (MMP13) CLIA Kit
EKU09575 96 Tests

Mouse Matrix Metalloproteinase 13 (MMP13) CLIA Kit

Sign In for Pricing
View Details