Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SNAP29 protein

This Human SNAP29 protein spans the amino acid sequence from region 1-258aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Soluble 29KDA NSF attachment protein Vesicle-membrane fusion protein SNAP-29

UniProt

O95721

Expression Region

1-258aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-225AA: 1-258AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSAYPKSYNPFDDDGEDEGARPAPWRDARDLPDGPDAPADRQQYLRQEVLRRAEATAASTSRSLALMYESEKVGVASSEELARQRGVLERTEKMVDKMDQDLKISQKHINSIKSVFGGLVNYFKSKPVETPPEQNGTLTSQPNNRLKEAISTSKEQEAKYQASHPNLRKLDDTDPVPRGAGSAMSTDAYPKNPHLRAYHQKIDSNLDELSMGLGRLKDIALGMQTEIEEQDDILDRLTTKVDKLDVNIKSTERKVRQL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Triethylamine Phosphate
TN9407-01 50 mg

Triethylamine Phosphate

Sign In for Pricing
View Details
Triethylamine Phosphate
TN9407-02 100 mg

Triethylamine Phosphate

Sign In for Pricing
View Details
Epidermal Growth Factor, Pro-, Recombinant, Mouse (Pro-EGF, EGF) (BSA Free)
E3374-11PX 25 µg

Epidermal Growth Factor, Pro-, Recombinant, Mouse (Pro-EGF, EGF) (BSA Free)

Sign In for Pricing
View Details
5- (Trifluoromethoxy) pyridin-2-amine
WYB17188-01 0.1 g

5- (Trifluoromethoxy) pyridin-2-amine

Sign In for Pricing
View Details
5- (Trifluoromethoxy) pyridin-2-amine
WYB17188-02 0.25 g

5- (Trifluoromethoxy) pyridin-2-amine

Sign In for Pricing
View Details
5- (Trifluoromethoxy) pyridin-2-amine
WYB17188-03 0.5 g

5- (Trifluoromethoxy) pyridin-2-amine

Sign In for Pricing
View Details