Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HCCS protein

This Human HCCS protein spans the amino acid sequence from region 1-268aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Holocytochrome c-type synthase

UniProt

P53701

Expression Region

1-268aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cardiovascular Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-333AA: 1-268AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGLSPSAPAVAVQASNASASPPSGCPMHEGKMKGCPVNTEPSGPTCEKKTYSVPAHQERAYEYVECPIRGTAAENKENLDPSNLMPPPNQTPAPDQPFALSTVREESSIPRADSEKKWVYPSEQMFWNAMLKKGWKWKDEDISQKDMYNIIRIHNQNNEQAWKEILKWEALHAAECPCGPSLIRFGGKAKEYSPRARIRSWMGYELPFDRHDWIINRCGTEVRYVIDYYDGGEVNKDYQFTILDVRPALDSLSAVWDRMKVAWWRWTS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ChRM2 Polyclonal Antibody, PE-Cy5.5 Conjugated
bs-0236R-PE-Cy5.5 100 µL

ChRM2 Polyclonal Antibody, PE-Cy5.5 Conjugated

Sign In for Pricing
View Details
Mouse Tet3 activation kit by CRISPRa
GA212765 1 Kit

Mouse Tet3 activation kit by CRISPRa

Sign In for Pricing
View Details
Human/Mouse KDM4A Affinity Purified Polyclonal Ab
AF6434-SP 25 µg

Human/Mouse KDM4A Affinity Purified Polyclonal Ab

Sign In for Pricing
View Details
ACSL3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)
11215154 3x 1.0 µg DNA

ACSL3 CRISPR All-in-one AAV vector set (with saCas9)(Mouse)

Sign In for Pricing
View Details
Lentiviral human ADGRF2 sgRNA gene knockout kit - Lentiviral human ADGRF2 sgRNA gene knockout kit (25)
GTR15376080 1 Vial

Lentiviral human ADGRF2 sgRNA gene knockout kit - Lentiviral human ADGRF2 sgRNA gene knockout kit (25)

Sign In for Pricing
View Details
SNCB sgRNA CRISPR Lentivector (Human) (Target 1)
K2209702 1.0 µg DNA

SNCB sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details