Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PPP1R8 protein

This Human PPP1R8 protein spans the amino acid sequence from region 1-209aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Protein phosphatase 1 regulatory inhibitor subunit 8

UniProt

Q12972

Expression Region

1-209aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-195AA: 1-209AAFull Length : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGGEDDELKGLLGLPEEETELDNLTEFNTAHNKRISTLTIEEGNLDIQRPKRKRKNSRVTFSEDDEIINPEDVDPSVGRFRNMVQTAVVPVKKKRVEGPGSLGLEESGSRRMQNFAFSGGLYGGLPPTHSEAGSQPHGIHGTALIGGLPMPYPNLAPDVDLTPVVPSAVNMNPAPNPAVYNPEAVNEPKKKKYAKEAWPGKKPTPSLLILENGTHMASSDACHECKSMIAAAG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PLG Recombinant Protein (Mouse)
RP162890 100 µg

PLG Recombinant Protein (Mouse)

Sign In for Pricing
View Details
Connexin-26 (GJB2, Gap Junction beta-2 Protein, Cx26) (FITC)
125218-FITC 100 µL

Connexin-26 (GJB2, Gap Junction beta-2 Protein, Cx26) (FITC)

Sign In for Pricing
View Details
2-Chloro-5-methylphenylboronic acid
416944-01 100 mg

2-Chloro-5-methylphenylboronic acid

Sign In for Pricing
View Details
2-Chloro-5-methylphenylboronic acid
416944-02 250 mg

2-Chloro-5-methylphenylboronic acid

Sign In for Pricing
View Details
CASP2 siRNA (Human)
CRH0589-01 15 nmol

CASP2 siRNA (Human)

Sign In for Pricing
View Details
CASP2 siRNA (Human)
CRH0589-02 30 nmol

CASP2 siRNA (Human)

Sign In for Pricing
View Details