Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MLF1 protein

This Human MLF1 protein spans the amino acid sequence from region 1-268aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myelodysplasia-myeloid leukemia factor 1

UniProt

P58340

Expression Region

1-268aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-305AA: 1-268AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLEC4F sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K0462605 3x 1.0 µg

CLEC4F sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
UBE2D3 (NM_181889) Human Tagged Lenti ORF Clone
RC213686L3 10 µg

UBE2D3 (NM_181889) Human Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Anti-Src (KO Validated) Antibody
A2123-100 100 µL

Anti-Src (KO Validated) Antibody

Sign In for Pricing
View Details
RNF149 (2V18) Mouse Monoclonal antibody
E28PE5438 100 µL

RNF149 (2V18) Mouse Monoclonal antibody

Sign In for Pricing
View Details
2-(2-Bromoethyl)-1,3-dioxane
TRC-B687175-1G 1 g

2-(2-Bromoethyl)-1,3-dioxane

Sign In for Pricing
View Details
Slc25a26 AAV siRNA Pooled Vector
44008164 1.0 µg

Slc25a26 AAV siRNA Pooled Vector

Sign In for Pricing
View Details