Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MLF1 protein

This Human MLF1 protein spans the amino acid sequence from region 1-268aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Myelodysplasia-myeloid leukemia factor 1

UniProt

P58340

Expression Region

1-268aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-305AA: 1-268AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFRMLNSSFEDDPFFSESILAHRENMRQMIRSFSEPFGRDLLSISDGRGRAHNRRGHNDGEDSLTHTDVSSFQTMDQMVSNMRNYMQKLERNFGQLSVDPNGHSFCSSSVMTYSKIGDEPPKVFQASTQTRRAPGGIKETRKAMRDSDSGLEKMAIGHHIHDRAHVIKKSKNKKTGDEEVNQEFINMNESDAHAFDEEWQSEVLKYKPGRHNLGNTRMRSVGHENPGSRELKRREKPQQSPAIEHGRRSNVLGDKLHIKGSSVKSNKK

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ubiquitin-conjugating enzyme E2 B
AP88656-01 50 µg

Ubiquitin-conjugating enzyme E2 B

Sign In for Pricing
View Details
Ubiquitin-conjugating enzyme E2 B
AP88656-02 100 µg

Ubiquitin-conjugating enzyme E2 B

Sign In for Pricing
View Details
Ubiquitin-conjugating enzyme E2 B
AP88656-03 1 mg

Ubiquitin-conjugating enzyme E2 B

Sign In for Pricing
View Details
Mouse Monoclonal CD24 Antibody (ML5) [Alexa Fluor 350]
NB100-77903AF350 0.1 mL

Mouse Monoclonal CD24 Antibody (ML5) [Alexa Fluor 350]

Sign In for Pricing
View Details
6-Fluorochroman-4-one 99+% (HPLC)
234706-01 5 g

6-Fluorochroman-4-one 99+% (HPLC)

Sign In for Pricing
View Details
6-Fluorochroman-4-one 99+% (HPLC)
234706-02 25 g

6-Fluorochroman-4-one 99+% (HPLC)

Sign In for Pricing
View Details