Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human WDR38 protein

This Human WDR38 protein spans the amino acid sequence from region 1-314aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

WDR38, WD repeat-containing protein 38

UniProt

Q5JTN6

Expression Region

1-314aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

61.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-268AA: 1-314AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MNSGVPATLAVRRVKFFGQHGGEVNSSAFSPDGQMLLTGSEDGCVYGWETRSGQLLWRLGGHTGPVKFCRFSPDGHLFASASCDCTVRLWDVARAKCLRVLKGHQRSVETVSFSPDSRQLASGGWDKRVMLWDVQSGQMLRLLVGHRDSIQSSDFSPTVNCLATGSWDSTVHIWDLRMVTPAVSHQALEGHSANISCLCYSASGLLASGSWDKTIHIWKPTTSSLLIQLKGHVTWVKSIAFSPDELWLASAGYSRMVKVWDCNTGKCLETLKGVLDVAHTCAFTPDGKILVSGAADQTRRQISRTSKSPRDPQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Nori Feline CD200 ELISA Kit
GR188309 96 Well

Nori Feline CD200 ELISA Kit

Sign In for Pricing
View Details
Monkey Mediator of RNA polymerase II transcription subunit 13 (MED13) ELISA Kit
MBS7217338-01 48 Well

Monkey Mediator of RNA polymerase II transcription subunit 13 (MED13) ELISA Kit

Sign In for Pricing
View Details
Monkey Mediator of RNA polymerase II transcription subunit 13 (MED13) ELISA Kit
MBS7217338-02 96 Well

Monkey Mediator of RNA polymerase II transcription subunit 13 (MED13) ELISA Kit

Sign In for Pricing
View Details
Monkey Mediator of RNA polymerase II transcription subunit 13 (MED13) ELISA Kit
MBS7217338-03 5x 96 Well

Monkey Mediator of RNA polymerase II transcription subunit 13 (MED13) ELISA Kit

Sign In for Pricing
View Details
Monkey Mediator of RNA polymerase II transcription subunit 13 (MED13) ELISA Kit
MBS7217338-04 10x 96 Well

Monkey Mediator of RNA polymerase II transcription subunit 13 (MED13) ELISA Kit

Sign In for Pricing
View Details
Daphmacropodine
orb1680719 5 mg

Daphmacropodine

Sign In for Pricing
View Details