Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAC3 protein

This Human RAC3 protein spans the amino acid sequence from region 1-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P21-Rac3

UniProt

P60763

Expression Region

1-192aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-237AA: 1-192AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Dbt 3'UTR Lenti-reporter-Luc Vector
17693086 1.0 µg

Dbt 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Anti-p97 ATPase, 58.13.3, mouse mab
65278 500 µL

Anti-p97 ATPase, 58.13.3, mouse mab

Sign In for Pricing
View Details
FEZ1 (Fasciculation and Elongation Protein Zeta 1)
315718 100 µL

FEZ1 (Fasciculation and Elongation Protein Zeta 1)

Sign In for Pricing
View Details
TPPP Rabbit Monoclonal Antibody
AMRe84543-01 1 Each

TPPP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TPPP Rabbit Monoclonal Antibody
AMRe84543-02 50 µL

TPPP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
TPPP Rabbit Monoclonal Antibody
AMRe84543-03 100 µL

TPPP Rabbit Monoclonal Antibody

Sign In for Pricing
View Details