Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAC3 protein

This Human RAC3 protein spans the amino acid sequence from region 1-192aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P21-Rac3

UniProt

P60763

Expression Region

1-192aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

48 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-237AA: 1-192AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPHTPILLVGTKLDLRDDKDTIERLRDKKLAPITYPQGLAMAREIGSVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKPGKKC

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sp140 (NM_001012133) Rat Tagged ORF Clone
RR211764 10 µg

Sp140 (NM_001012133) Rat Tagged ORF Clone

Sign In for Pricing
View Details
NID1 Adenovirus (Mouse)
31828054 1.0 mL

NID1 Adenovirus (Mouse)

Sign In for Pricing
View Details
Smoothened Agonist (SAG)
orb1223671-01 500 mg

Smoothened Agonist (SAG)

Sign In for Pricing
View Details
Smoothened Agonist (SAG)
orb1223671-02 1 g

Smoothened Agonist (SAG)

Sign In for Pricing
View Details
Smoothened Agonist (SAG)
orb1223671-03 5 mg

Smoothened Agonist (SAG)

Sign In for Pricing
View Details
Smoothened Agonist (SAG)
orb1223671-04 10 mg

Smoothened Agonist (SAG)

Sign In for Pricing
View Details