What is the catalog number for Human RAB23 protein?

The catalog number for Human RAB23 protein is orb54484.

What sizes are available for Human RAB23 protein?

Human RAB23 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human RAB23 protein come in?

Human RAB23 protein is available in 3 different pack sizes.

Is Human RAB23 protein in stock?

Human RAB23 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human RAB23 protein

This Human RAB23 protein spans the amino acid sequence from region 1-237aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DKFZp781H0695, HSPC137, MGC8900, Rab 23, RAB family small GTP binding protein RAB 23, Rab23, RAB23, member RAS oncogene family, RAB23_HUMAN, Ras related protein Rab 23, Ras-related protein Rab-23

UniProt

Q9ULC3

Expression Region

1-237aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-212AA: 1-237AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP