Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RAB23 protein

This Human RAB23 protein spans the amino acid sequence from region 1-237aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DKFZp781H0695, HSPC137, MGC8900, Rab 23, RAB family small GTP binding protein RAB 23, Rab23, RAB23, member RAS oncogene family, RAB23_HUMAN, Ras related protein Rab 23, Ras-related protein Rab-23

UniProt

Q9ULC3

Expression Region

1-237aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

53.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-212AA: 1-237AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MLEEDMEVAIKMVVVGNGAVGKSSMIQRYCKGIFTKDYKKTIGVDFLERQIQVNDEDVRLMLWDTAGQEEFDAITKAYYRGAQACVLVFSTTDRESFEAVSSWREKVVAEVGDIPTVLVQNKIDLLDDSCIKNEEAEALAKRLKLRFYRTSVKEDLNVNEVFKYLAEKYLQKLKQQIAEDPELTHSSSNKIGVFNTSGGSHSGQNSGTLNGGDVINLRPNKQRTKKNRNPFSSCSIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Aniline phosphinate
HDA39588-01 50 g

Aniline phosphinate

Sign In for Pricing
View Details
Aniline phosphinate
HDA39588-02 100 g

Aniline phosphinate

Sign In for Pricing
View Details
KLHL14 CRISPR All-in-one AAV vector set (with saCas9)(Rat)
25778156 3x 1.0 µg DNA

KLHL14 CRISPR All-in-one AAV vector set (with saCas9)(Rat)

Sign In for Pricing
View Details
Hydrochloric Acid 37%
40800056-1 500 mL

Hydrochloric Acid 37%

Sign In for Pricing
View Details
Rabbit Parkinson Disease Protein 2 ELISA Kit
MBS081697 Inquire

Rabbit Parkinson Disease Protein 2 ELISA Kit

Sign In for Pricing
View Details
Araf (NM_001159645) Mouse Tagged ORF Clone
MR226088 10 µg

Araf (NM_001159645) Mouse Tagged ORF Clone

Sign In for Pricing
View Details