Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human KHK protein

This Human KHK protein spans the amino acid sequence from region 1-298aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Hepatic fructokinase

UniProt

P50053

Expression Region

1-298aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

59.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-64AA: 1-298AAFull Length of Isoform 2 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

DUSP5 Antibody
MBS9430035-01 0.1 mL

DUSP5 Antibody

Sign In for Pricing
View Details
DUSP5 Antibody
MBS9430035-02 5x 0.1 mL

DUSP5 Antibody

Sign In for Pricing
View Details
Anti-CD50 Antibody, Mouse Monoclonal
MBS8102300-01 0.02 mL

Anti-CD50 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD50 Antibody, Mouse Monoclonal
MBS8102300-02 0.1 mL

Anti-CD50 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-CD50 Antibody, Mouse Monoclonal
MBS8102300-03 5x 0.1 mL

Anti-CD50 Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Annexin IV/ANXA4 Rabbit Polyclonal Antibody (HRP)
orb2615894 100 µg

Annexin IV/ANXA4 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details