Human KHK protein
This Human KHK protein spans the amino acid sequence from region 1-298aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Hepatic fructokinase
UniProt
P50053
Expression Region
1-298aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Metabolism Research
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
59.7 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-64AA: 1-298AAFull Length of Isoform 2 : Full Length of Isoform 2
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MEEKQILCVGLVVLDVISLVDKYPKEDSEIRCLSQRWQRGGNASNSCTVLSLLGAPCAFMGSMAPGHVADFVLDDLRRYSVDLRYTVFQTTGSVPIATVIINEASGSRTILYYDRSLPDVSATDFEKVDLTQFKWIHIEGRNASEQVKMLQRIDAHNTRQPPEQKIRVSVEVEKPREELFQLFGYGDVVFVSKDVAKHLGFQSAEEALRGLYGRVRKGAVLVCAWAEEGADALGPDGKLLHSDAFPPPRVVDTLGAGDTFNASVIFSLSQGRSVQEALRFGCQVAGKKCGLQGFDGIV
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
C6190 96 Tests
Corticotropin Releasing Factor binding protein (CRHBP) Chicken ELISA Kit
Sign In for Pricing
View Details GTR15282001 1 Vial
Lentiviral mouse Atpsckmt shRNA (UAS) - Lentiviral mouse Atpsckmt shRNA (UAS, RFP) plasmid
Sign In for Pricing
View Details 
AE60067RA-01 48 Tests
Rat Peroxisome proliferator-activated receptor gamma coactivator 1-beta (PPARGC1B) ELISA Kit
Sign In for Pricing
View Details AE60067RA-02 96 Tests
Rat Peroxisome proliferator-activated receptor gamma coactivator 1-beta (PPARGC1B) ELISA Kit
Sign In for Pricing
View Details A00293-1-Dylight550 100 µg
Anti-RET Antibody Picoband®, Dylight550 Conjugate
Sign In for Pricing
View Details MBS2101792-01 5x 96 Tests
Mouse Janus Kinase 1 (JAK1) Antibody Pair Kit (with Standard)
Sign In for Pricing
View Details