Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FXYD2 protein

This Human FXYD2 protein spans the amino acid sequence from region 1-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain

UniProt

P54710

Expression Region

1-64aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-333AA: 1-64AAFull Length : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Biotin antibody
MBS534316-01 1 mg

Biotin antibody

Sign In for Pricing
View Details
Biotin antibody
MBS534316-02 5x 1 mg

Biotin antibody

Sign In for Pricing
View Details
Ltb4r2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)
K7081808 1.0 µg DNA

Ltb4r2 sgRNA CRISPR/Cas9 All-in-One Lentivector (Rat) (Target 3)

Sign In for Pricing
View Details
TSEN2 Antibody
DF2255-01 100 µL

TSEN2 Antibody

Sign In for Pricing
View Details
TSEN2 Antibody
DF2255-02 200 µL

TSEN2 Antibody

Sign In for Pricing
View Details
HMGB2 (NM_002129) Human Recombinant Protein
TP300750M 100 µg

HMGB2 (NM_002129) Human Recombinant Protein

Sign In for Pricing
View Details