Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FXYD2 protein

This Human FXYD2 protein spans the amino acid sequence from region 1-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain

UniProt

P54710

Expression Region

1-64aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-333AA: 1-64AAFull Length : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Titanium silicide, 99%
GX4809-25g 25 g

Titanium silicide, 99%

Sign In for Pricing
View Details
Mouse Ubxn4 Pre-designed siRNA Set B
SI115638B 1 Each

Mouse Ubxn4 Pre-designed siRNA Set B

Sign In for Pricing
View Details
Anti-Kallikrein 10/KLK10 Antibody Picoband® Fluoro594 Conjugated
PA1821-Fluoro594 100 µg/Vial

Anti-Kallikrein 10/KLK10 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
2- (2-Phenylethoxy) ethan-1-ol
ZCA12191-01 250 mg

2- (2-Phenylethoxy) ethan-1-ol

Sign In for Pricing
View Details
2- (2-Phenylethoxy) ethan-1-ol
ZCA12191-02 2.5 g

2- (2-Phenylethoxy) ethan-1-ol

Sign In for Pricing
View Details
Lentiviral mouse Ppp1r3f shRNA (UAS) - Lentiviral mouse Ppp1r3f shRNA (UAS) plasmid
GTR15272587 1 Vial

Lentiviral mouse Ppp1r3f shRNA (UAS) - Lentiviral mouse Ppp1r3f shRNA (UAS) plasmid

Sign In for Pricing
View Details