Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FXYD2 protein

This Human FXYD2 protein spans the amino acid sequence from region 1-64aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

FXYD domain-containing ion transport regulator 2 Sodium pump gamma chain

UniProt

P54710

Expression Region

1-64aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

34.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-333AA: 1-64AAFull Length : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDRWYLGGSPKGDVDPFYYDYETVRNGGLIFAGLAFIVGLLILLSRRFRCGGNKKRRQINEDEP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Brazilin (Brasilin)
300022 10 mg

Brazilin (Brasilin)

Sign In for Pricing
View Details
HIP1 Human shRNA Lentiviral Particle (Locus ID 3092)
TL312457V 500 µL Each

HIP1 Human shRNA Lentiviral Particle (Locus ID 3092)

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Recombinant, Human
155195-01 10 µg

Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Recombinant, Human

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Recombinant, Human
155195-02 50 µg

Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Recombinant, Human

Sign In for Pricing
View Details
Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Recombinant, Human
155195-03 200 µg

Insulin Like Growth Factor Binding Protein 3 (IGFBP3) Recombinant, Human

Sign In for Pricing
View Details
THEM2 (ACOT13) (NM_018473) Human Tagged ORF Clone Lentiviral Particle
RC201505L1V 200 µL

THEM2 (ACOT13) (NM_018473) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details