Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human DHDDS protein

This Human DHDDS protein spans the amino acid sequence from region 1-333aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cis-isoprenyltransferase

UniProt

Q86SQ9

Expression Region

1-333aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

65.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-198AA: 1-333AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSWIKEGELSLWERFCANIIKAGPMPKHIAFIMDGNRRYAKKCQVERQEGHSQGFNKLAETLRWCLNLGILEVTVYAFSIENFKRSKSEVDGLMDLARQKFSRLMEEKEKLQKHGVCIRVLGDLHLLPLDLQELIAQAVQATKNYNKCFLNVCFAYTSRHEISNAVREMAWGVEQGLLDPSDISESLLDKCLYTNRSPHPDILIRTSGEVRLSDFLLWQTSHSCLVFQPVLWPEYTFWNLFEAILQFQMNHSVLQKARDMYAEERKRQQLERDQATVTEQLLREGLQASGDAQLRRTRLHKLSARREERVQGFLQALELKRADWLARLGTASA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIP1 Rabbit Polyclonal Antibody (HRP)
orb474546 100 µL

SIP1 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Ppip5k1 3'UTR Luciferase Stable Cell Line
TU216630 1.0 mL

Ppip5k1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SLC39A10 siRNA (Mouse)
orb1836728-01 15 nmol

SLC39A10 siRNA (Mouse)

Sign In for Pricing
View Details
SLC39A10 siRNA (Mouse)
orb1836728-02 30 nmol

SLC39A10 siRNA (Mouse)

Sign In for Pricing
View Details
Bovine keratin 14 ELISA Kit
OM624627 96 Strip Well

Bovine keratin 14 ELISA Kit

Sign In for Pricing
View Details
TIMELESS antibody
20R-1198 100 µL

TIMELESS antibody

Sign In for Pricing
View Details