Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SUPT4H1 protein

This Human SUPT4H1 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DRB sensitivity-inducing factor 14KDA subunit

UniProt

P63272

Expression Region

1-117aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-179AA: 1-117AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Discs, Large Homolog 4 (DLG4) BioAssayTM ELISA Kit (Mouse)
024693 96 Tests

Discs, Large Homolog 4 (DLG4) BioAssayTM ELISA Kit (Mouse)

Sign In for Pricing
View Details
PCK2 Protein Vector (Mouse) (pPM-C-HA)
PV214244 500 ng

PCK2 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
NXF1 Recombinant Antibody, APC-Cy5.5 Conjugated
bsm-61943R-APC-Cy5.5 100 µL

NXF1 Recombinant Antibody, APC-Cy5.5 Conjugated

Sign In for Pricing
View Details
Genesig kit for Mycoplasma gallisepticum, Easy
348570 1 Kit

Genesig kit for Mycoplasma gallisepticum, Easy

Sign In for Pricing
View Details
Mouse Adrenocorticotropic Hormone ELISA Kit
MBS041160-01 48 Well

Mouse Adrenocorticotropic Hormone ELISA Kit

Sign In for Pricing
View Details
Mouse Adrenocorticotropic Hormone ELISA Kit
MBS041160-02 96 Well

Mouse Adrenocorticotropic Hormone ELISA Kit

Sign In for Pricing
View Details