Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SUPT4H1 protein

This Human SUPT4H1 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DRB sensitivity-inducing factor 14KDA subunit

UniProt

P63272

Expression Region

1-117aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-179AA: 1-117AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) JEN1 Polyclonal Antibody
MBS7158292 Inquire

Rabbit anti-Saccharomyces cerevisiae (strain 204508/S288c)(Baker's yeast) JEN1 Polyclonal Antibody

Sign In for Pricing
View Details
OAMA00845-10UG - proANP Antibody
OAMA00845-10UG 0.01 mg

OAMA00845-10UG - proANP Antibody

Sign In for Pricing
View Details
2', 3'-cyclic-nucleotide 3'-phosphodiesterase
AP81858 1 mg

2', 3'-cyclic-nucleotide 3'-phosphodiesterase

Sign In for Pricing
View Details
Scc-2 Antibody
orb801332 2 mg

Scc-2 Antibody

Sign In for Pricing
View Details
Eg5/KIF11 Rabbit Polyclonal Antibody (HRP)
orb2594258 100 µg

Eg5/KIF11 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Mouse Monoclonal COG6 Antibody (OTI1B8) - Azide and BSA Free
NBP2-72088 100 µg

Mouse Monoclonal COG6 Antibody (OTI1B8) - Azide and BSA Free

Sign In for Pricing
View Details