Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human SUPT4H1 protein

This Human SUPT4H1 protein spans the amino acid sequence from region 1-117aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

DRB sensitivity-inducing factor 14KDA subunit

UniProt

P63272

Expression Region

1-117aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

40.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-179AA: 1-117AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ALETVPKDLRHLRACLLCSLVKTIDQFEYDGCDNCDAYLQMKGNREMVYDCTSSSFDGIIAMMSPEDSWVSKWQRVSNFKPGVYAVSVTGRLPQGIVRELKSRGVAYKSRDTAIKT

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD163 Monoclonal Antibody, AbBy Fluor™ 594 Conjugated
bsm-43679M-BF594 100 µL

CD163 Monoclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
Methyl 6- (chloromethyl) pyridine-3-carboxylate hydrochloride
BNB30653-01 0.5 g

Methyl 6- (chloromethyl) pyridine-3-carboxylate hydrochloride

Sign In for Pricing
View Details
Methyl 6- (chloromethyl) pyridine-3-carboxylate hydrochloride
BNB30653-02 5 g

Methyl 6- (chloromethyl) pyridine-3-carboxylate hydrochloride

Sign In for Pricing
View Details
Nqo2 Polyclonal Antibody
A50973-020 20 µL

Nqo2 Polyclonal Antibody

Sign In for Pricing
View Details
Olr1138 Recombinant Protein (Rat)
RP215405 100 µg

Olr1138 Recombinant Protein (Rat)

Sign In for Pricing
View Details
Density ReguLated Protein (DENR) (NM_003677) Human Tagged ORF Clone Lentiviral Particle
RC203227L4V 200 µL

Density ReguLated Protein (DENR) (NM_003677) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details