Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MEOX1 protein

This Human MEOX1 protein spans the amino acid sequence from region 1-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mesenchyme homeobox 1

UniProt

P50221

Expression Region

1-254aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-109AA: 1-254AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KCNG2 Polyclonal Antibody
MBS2521375-01 0.02 mL

KCNG2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNG2 Polyclonal Antibody
MBS2521375-02 0.06 mL

KCNG2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNG2 Polyclonal Antibody
MBS2521375-03 0.12 mL

KCNG2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNG2 Polyclonal Antibody
MBS2521375-04 0.2 mL

KCNG2 Polyclonal Antibody

Sign In for Pricing
View Details
KCNG2 Polyclonal Antibody
MBS2521375-05 5x 0.2 mL

KCNG2 Polyclonal Antibody

Sign In for Pricing
View Details
Glucose 6 Phosphate Dehydrogenase Antibody [N10E9]
F4025-100uL 100 µL

Glucose 6 Phosphate Dehydrogenase Antibody [N10E9]

Sign In for Pricing
View Details