Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human MEOX1 protein

This Human MEOX1 protein spans the amino acid sequence from region 1-254aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Mesenchyme homeobox 1

UniProt

P50221

Expression Region

1-254aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-109AA: 1-254AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDPAASSCMRSLQPPAPVWGCLRNPHSEGNGASGLPHYPPTPFSFHQKPDFLATATAAYPDFSASCLAATPHSLPQEEHIFTEQHPAFPQSPNWHFPVSDARRRPNSGPAGGSKEMGTSSLGLVDTTGGPGDDYGVLGSTANETEKKSSRRRKESSDNQENRGKPEGSSKARKERTAFTKEQLRELEAEFAHHNYLTRLRRYEIAVNLDLSERQVKVWFQNRRMKWKRVKGGQPISPNGQDPEDGDSTASPSSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Prokineticin Receptor 2 ELISA Kit
MBS748904-01 48 Well

Bovine Prokineticin Receptor 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Prokineticin Receptor 2 ELISA Kit
MBS748904-02 96 Well

Bovine Prokineticin Receptor 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Prokineticin Receptor 2 ELISA Kit
MBS748904-03 5x 96 Well

Bovine Prokineticin Receptor 2 ELISA Kit

Sign In for Pricing
View Details
Bovine Prokineticin Receptor 2 ELISA Kit
MBS748904-04 10x 96 Well

Bovine Prokineticin Receptor 2 ELISA Kit

Sign In for Pricing
View Details
CCDC160 (NM_001101357) Human Over-expression Lysate
LS347475-20ug 20 µg

CCDC160 (NM_001101357) Human Over-expression Lysate

Sign In for Pricing
View Details
TNFSF15 Rabbit Polyclonal Antibody (HRP)
orb469098 100 µL

TNFSF15 Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details