Human GTF2A2 protein
This Human GTF2A2 protein spans the amino acid sequence from region 1-109aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
General transcription factor IIA subunit 2 TFIIA p12 subunit
UniProt
P52657
Expression Region
1-109aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Epigenetics & Chromatin
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
39.5 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-117AA: 1-109AAFull Length : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINAALAQRVRNRVNFRGSLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKNTGSNTTE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
213254-01 20 µL
SATB1 (Special AT-rich Sequence Binding Protein 1, DNA Binding Protein SATB1) discontinued
Sign In for Pricing
View Details 213254-02 100 µL
SATB1 (Special AT-rich Sequence Binding Protein 1, DNA Binding Protein SATB1) discontinued
Sign In for Pricing
View Details 
MBS1398050-01 0.02 mg (E-Coli)
Recombinant Xanthomonas axonopodis pv. citri UPF0301 protein XAC2918 (XAC2918)
Sign In for Pricing
View Details