Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human BLID protein

This Human BLID protein spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Breast cancer cell protein 2

UniProt

Q8IZY5

Expression Region

1-108aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

39 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-202AA: 1-108AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVTLLPIEGQEIHFFEILESECVLYTGWIERASGSSIYPEAKARLPLEALLGSNKEPMLPKETVLSLKRYNLGSSAMKRNVPGHVLQRPSYLTRIQVTLLCNSSAEAL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Anti Human ALDH3A1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence)
IRBAMLALDH3A1AP97120UL 1 Each

Rabbit Anti Human ALDH3A1 Polyclonal Affinity Purified (PBS with 0.02% sodium azide, 50% glycerol, pH7.3) (Immunofluorescence)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein EC1118_1L10_0100g (EC1118_1L10_0100g)
orb2920875-01 20 µg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein EC1118_1L10_0100g (EC1118_1L10_0100g)

Sign In for Pricing
View Details
Recombinant Saccharomyces cerevisiae Putative uncharacterized protein EC1118_1L10_0100g (EC1118_1L10_0100g)
orb2920875-02 100 µg

Recombinant Saccharomyces cerevisiae Putative uncharacterized protein EC1118_1L10_0100g (EC1118_1L10_0100g)

Sign In for Pricing
View Details
Bcl-2 Recombinant Rabbit mAb, PerCP-Cy7 conjugated
orb2979927 100 µL

Bcl-2 Recombinant Rabbit mAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
CATSPER2, CT (CATSPER2, Cation channel sperm-associated protein 2) (MaxLight 405) discontinued
033226-ML405 100 µL

CATSPER2, CT (CATSPER2, Cation channel sperm-associated protein 2) (MaxLight 405) discontinued

Sign In for Pricing
View Details
PSAT1 Antibody
orb3162625-01 50 µL

PSAT1 Antibody

Sign In for Pricing
View Details