Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TXNL4B protein

This Human TXNL4B protein spans the amino acid sequence from region 1-149aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Dim1-like protein

UniProt

Q9NX01

Expression Region

1-149aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

44 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-324AA: 1-149AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSFLLPKLTSKKEVDQAIKSTAEKVLVLRFGRDEDPVCLQLDDILSKTSSDLSKMAAIYLVDVDQTAVYTQYFDISYIPSTVFFFNGQHMKVDYGSPDHTKFVGSFKTKQDFIDLIEVIYRGAMRGKLIVQSPIDPKNIPKYDLLYQDI

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-β-Tubulin (BT7R)
79468 100 µg

Anti-β-Tubulin (BT7R)

Sign In for Pricing
View Details
R Cadherin Polyclonal Antibody, Cy3 Conjugated
bs-11196R-Cy3 100 µL

R Cadherin Polyclonal Antibody, Cy3 Conjugated

Sign In for Pricing
View Details
Lentiviral mouse Cdc25a shRNA (UAS) - Lentiviral mouseCdc25a shRNA (UAS, GFP) (25)
GTR15189344 1 Vial

Lentiviral mouse Cdc25a shRNA (UAS) - Lentiviral mouseCdc25a shRNA (UAS, GFP) (25)

Sign In for Pricing
View Details
HDAC7A (Histone Deacetylase 7, HD7, Histone Deacetylase 7A, HD7a, HDAC7A, DKFZp586J0917, DKFZP586J0917, FLJ99588)
127770 100 µg

HDAC7A (Histone Deacetylase 7, HD7, Histone Deacetylase 7A, HD7a, HDAC7A, DKFZp586J0917, DKFZP586J0917, FLJ99588)

Sign In for Pricing
View Details
Goat Anti-Mouse IgG (H&L) Biotin
MBS4516861-01 0.1 mL

Goat Anti-Mouse IgG (H&L) Biotin

Sign In for Pricing
View Details
Goat Anti-Mouse IgG (H&L) Biotin
MBS4516861-02 0.5 mL

Goat Anti-Mouse IgG (H&L) Biotin

Sign In for Pricing
View Details