Human TRIAP1 protein
This Human TRIAP1 protein spans the amino acid sequence from region 1-76aa. Purity: Greater than 90% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Protein 15E1.1 WF-1 p53-inducible cell-survival factor
UniProt
O43715
Expression Region
1-76aa
Tag
N-terminal GST-tagged
Source
E.coli
Origin
Homo sapiens (Human)
Field of Research
Cell Biology
Purity
Greater than 90% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
35.8 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
N-terminal GST-tagged: N-terminal GST-tagged1-108AA: 1-76AAFull Length of BC069399 : Full Length
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MNSVGEACTDMKREYDQCFNRWFAEKFLKGDSSGDPCTDLFKRYQQCVQKAIKEKEIPIEGLEFMGHGKEKPENSS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
TMPH-03376-01 5 µg
SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO)
Sign In for Pricing
View Details TMPH-03376-02 10 µg
SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO)
Sign In for Pricing
View Details TMPH-03376-03 20 µg
SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO)
Sign In for Pricing
View Details TMPH-03376-04 50 µg
SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO)
Sign In for Pricing
View Details TMPH-03376-05 100 µg
SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO)
Sign In for Pricing
View Details TMPH-03376-06 200 µg
SULT1A1 Protein, Rat, Recombinant (His & Myc & SUMO)
Sign In for Pricing
View Details