Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human TP53AIP1 protein

This Human TP53AIP1 protein spans the amino acid sequence from region 1-108aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

P53 regulated apoptosis inducing protein 1, p53-regulated apoptosis-inducing protein 1, P53AIP 1, p53AIP1, TP53AIP 1, TP53AIP1, TPIP1_HUMAN

UniProt

Q9HCN2

Expression Region

1-108aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-147AA: 1-108AAFull Length : Full Length of BC069399

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSSSEVSFRSAQASCSGARRQGLGRGDQNLSVMPPNGRAQTHTPGWVSPCSENRDGLLPATAPGRLCSHRGADIPSFQTHQDPVTASGSSELHADCPQFRALDRAGN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Sheep Olfactory receptor 1J4 (OR1J4) ELISA kit
GTR10395911 96 Well

Sheep Olfactory receptor 1J4 (OR1J4) ELISA kit

Sign In for Pricing
View Details
Collagen IV Rabbit Polyclonal Antibody (PerCP)
orb1577928 100 µL

Collagen IV Rabbit Polyclonal Antibody (PerCP)

Sign In for Pricing
View Details
BTN3A3 Antibody (HRP)
orb354090-01 50 µg

BTN3A3 Antibody (HRP)

Sign In for Pricing
View Details
BTN3A3 Antibody (HRP)
orb354090-02 100 µg

BTN3A3 Antibody (HRP)

Sign In for Pricing
View Details
ZFX sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
K2675305 3x 1.0 µg

ZFX sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
RplX Antibody
orb826387 2 mg

RplX Antibody

Sign In for Pricing
View Details