Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NUDT2 protein

This Human NUDT2 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Diadenosine 5',5'''-P1, P4-tetraphosphate asymmetrical hydrolase

UniProt

P50583

Expression Region

1-147aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-166AA: 1-147AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TICAM1 siRNA (Mouse)
CRN0786-01 15 nmol

TICAM1 siRNA (Mouse)

Sign In for Pricing
View Details
TICAM1 siRNA (Mouse)
CRN0786-02 30 nmol

TICAM1 siRNA (Mouse)

Sign In for Pricing
View Details
Anti-EpCAM Antibody, Mouse Monoclonal
MBS8103563-01 0.02 mL

Anti-EpCAM Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-EpCAM Antibody, Mouse Monoclonal
MBS8103563-02 0.1 mL

Anti-EpCAM Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
Anti-EpCAM Antibody, Mouse Monoclonal
MBS8103563-03 5x 0.1 mL

Anti-EpCAM Antibody, Mouse Monoclonal

Sign In for Pricing
View Details
TNFRSF21, Recombinant, Human, aa371-655, His-SUMO-Tag (Tumor Necrosis Factor Receptor Superfamily Member 21)
375624-01 20 µg

TNFRSF21, Recombinant, Human, aa371-655, His-SUMO-Tag (Tumor Necrosis Factor Receptor Superfamily Member 21)

Sign In for Pricing
View Details