Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NUDT2 protein

This Human NUDT2 protein spans the amino acid sequence from region 1-147aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Diadenosine 5',5'''-P1, P4-tetraphosphate asymmetrical hydrolase

UniProt

P50583

Expression Region

1-147aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-166AA: 1-147AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALRACGLIIFRRCLIPKVDNNAIEFLLLQASDGIHHWTPPKGHVEPGEDDLETALRETQEEAGIEAGQLTIIEGFKRELNYVARNKPKTVIYWLAEVKDYDVEIRLSHEHQAYRWLGLEEACQLAQFKEMKAALQEGHQFLCSIEA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LentimiRa-hsa-miR-511-5p Vector
mh40759 500 ng

LentimiRa-hsa-miR-511-5p Vector

Sign In for Pricing
View Details
HSP60 Mouse Monoclonal Antibody
orb705450-01 30 µL

HSP60 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HSP60 Mouse Monoclonal Antibody
orb705450-02 50 μL

HSP60 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HSP60 Mouse Monoclonal Antibody
orb705450-03 100 µL

HSP60 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
HSP60 Mouse Monoclonal Antibody
orb705450-04 200 µL

HSP60 Mouse Monoclonal Antibody

Sign In for Pricing
View Details
SPRR1A Protein Vector (Human) (pPB-N-His)
PV133215 500 ng

SPRR1A Protein Vector (Human) (pPB-N-His)

Sign In for Pricing
View Details