Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RGS5 protein

This Human RGS5 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129, Regulator of G Protein Signalling 5, Regulator of G-protein signaling 5, RGS 5, RGS5, RGS5_HUMAN

UniProt

O15539

Expression Region

1-181aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-265AA: 1-181AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF-YA Lentiviral Activation Particles (m2)
sc-421885-LAC-2 200 µL

NF-YA Lentiviral Activation Particles (m2)

Sign In for Pricing
View Details
CRYL1 Protein Vector (Human) (pPB-C-His)
PV070913 500 ng

CRYL1 Protein Vector (Human) (pPB-C-His)

Sign In for Pricing
View Details
Mouse mmu-miR-7025-3p miRNA Agomir
abx884109-01 5 nmol

Mouse mmu-miR-7025-3p miRNA Agomir

Sign In for Pricing
View Details
Mouse mmu-miR-7025-3p miRNA Agomir
abx884109-02 10 nmol

Mouse mmu-miR-7025-3p miRNA Agomir

Sign In for Pricing
View Details
NUDC Antibody
orb1267813 400 μl

NUDC Antibody

Sign In for Pricing
View Details
5' ATTO-390 / 3' DABCYL
orb1734404 30 to 49 nmol

5' ATTO-390 / 3' DABCYL

Sign In for Pricing
View Details