What is the catalog number for Human RGS5 protein?

The catalog number for Human RGS5 protein is orb54448.

What sizes are available for Human RGS5 protein?

Human RGS5 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human RGS5 protein come in?

Human RGS5 protein is available in 3 different pack sizes.

Is Human RGS5 protein in stock?

Human RGS5 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human RGS5 protein

This Human RGS5 protein spans the amino acid sequence from region 1-181aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MST092, MST106, MST129, MSTP032, MSTP092, MSTP106, MSTP129, Regulator of G Protein Signalling 5, Regulator of G-protein signaling 5, RGS 5, RGS5, RGS5_HUMAN

UniProt

O15539

Expression Region

1-181aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-265AA: 1-181AAFull Length of Isoform 2 : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MCKGLAALPHSCLERAKEIKIKLGILLQKPDSVGDLVIPYNEKPEKPAKTQKTSLDEALQWRDSLDKLLQNNYGLASFKSFLKSEFSEENLEFWIACEDYKKIKSPAKMAEKAKQIYEEFIQTEAPKEVNIDHFTKDITMKNLVEPSLSSFDMAQKRIHALMEKDSLPRFVRSEFYQELIK