Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDCD5 protein

This Human PDCD5 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TF-1 cell apoptosis-related protein 19

UniProt

O14737

Expression Region

1-125aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-207AA: 1-125AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

BID HDR Plasmid (m)
sc-419329-HDR 20 µg

BID HDR Plasmid (m)

Sign In for Pricing
View Details
Tec (NM_001113460) Mouse Untagged Clone
MC219908 10 µg

Tec (NM_001113460) Mouse Untagged Clone

Sign In for Pricing
View Details
Anti-Cathepsin K (CTSK)
FY-AB48526-01 1 mL

Anti-Cathepsin K (CTSK)

Sign In for Pricing
View Details
Anti-Cathepsin K (CTSK)
FY-AB48526-02 100 µL

Anti-Cathepsin K (CTSK)

Sign In for Pricing
View Details
Anti-Cathepsin K (CTSK)
FY-AB48526-03 200 µL

Anti-Cathepsin K (CTSK)

Sign In for Pricing
View Details
CD300 (CD300LF) Human qPCR Template Standard (NM_139018)
HK211705 1 Kit

CD300 (CD300LF) Human qPCR Template Standard (NM_139018)

Sign In for Pricing
View Details