Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDCD5 protein

This Human PDCD5 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TF-1 cell apoptosis-related protein 19

UniProt

O14737

Expression Region

1-125aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-207AA: 1-125AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-SKI-1 antibody
STJ95674 200 µl

Anti-SKI-1 antibody

Sign In for Pricing
View Details
SELENBP1 Antibody
KC-41518-01 50 μL

SELENBP1 Antibody

Sign In for Pricing
View Details
SELENBP1 Antibody
KC-41518-02 100 µL

SELENBP1 Antibody

Sign In for Pricing
View Details
SELENBP1 Antibody
KC-41518-03 1 mL

SELENBP1 Antibody

Sign In for Pricing
View Details
Rat Endothelin 2 (EDN2) ELISA Kit
EKU03891 96 Tests

Rat Endothelin 2 (EDN2) ELISA Kit

Sign In for Pricing
View Details
ZNF674 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2724408 1.0 µg DNA

ZNF674 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details