Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human PDCD5 protein

This Human PDCD5 protein spans the amino acid sequence from region 1-125aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

TF-1 cell apoptosis-related protein 19

UniProt

O14737

Expression Region

1-125aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

41.2 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-207AA: 1-125AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MADEELEALRRQRLAELQAKHGDPGDAAQQEAKHREAEMRNSILAQVLDQSARARLSNLALVKPEKTKAVENYLIQMARYGQLSEKVSEQGLIEILKKVSQQTEKTTTVKFNRRKVMDSDEDDDY

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Elongation Factor 1A1 Rabbit mAb
MBS4761531-01 0.1 mL

Elongation Factor 1A1 Rabbit mAb

Sign In for Pricing
View Details
Elongation Factor 1A1 Rabbit mAb
MBS4761531-02 5x 0.1 mL

Elongation Factor 1A1 Rabbit mAb

Sign In for Pricing
View Details
4933403F05Rik shRNA (m) Lentiviral Particles
sc-140269-V 200 µL

4933403F05Rik shRNA (m) Lentiviral Particles

Sign In for Pricing
View Details
FUSIP1, CT (SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR, Serine/arginine-rich splicing factor 10, 40kD SR-repressor protein, FUS-interacting serine-arginine-rich protein 1, Splicing factor SRp38, Splicing factor, arginine/serine-rich 13A, TLS-associated protein
MBS6300339-01 0.1 mL

FUSIP1, CT (SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR, Serine/arginine-rich splicing factor 10, 40kD SR-repressor protein, FUS-interacting serine-arginine-rich protein 1, Splicing factor SRp38, Splicing factor, arginine/serine-rich 13A, TLS-associated protein

Sign In for Pricing
View Details
FUSIP1, CT (SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR, Serine/arginine-rich splicing factor 10, 40kD SR-repressor protein, FUS-interacting serine-arginine-rich protein 1, Splicing factor SRp38, Splicing factor, arginine/serine-rich 13A, TLS-associated protein
MBS6300339-02 5x 0.1 mL

FUSIP1, CT (SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR, Serine/arginine-rich splicing factor 10, 40kD SR-repressor protein, FUS-interacting serine-arginine-rich protein 1, Splicing factor SRp38, Splicing factor, arginine/serine-rich 13A, TLS-associated protein

Sign In for Pricing
View Details
Rabbit Monoclonal TIM-3 Antibody (2321C) [Janelia Fluor 646]
FAB23652J 0.1 mL

Rabbit Monoclonal TIM-3 Antibody (2321C) [Janelia Fluor 646]

Sign In for Pricing
View Details