Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H3D protein

This Human HIST1H3D protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l

UniProt

P68431

Expression Region

1-136aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-351AA: 1-136AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal EVG1 Antibody
NBP2-76489 100 µL

Rabbit Polyclonal EVG1 Antibody

Sign In for Pricing
View Details
Phospho-CaMK2 alpha (T286) Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61319R-BF555-01 20 µL

Phospho-CaMK2 alpha (T286) Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Phospho-CaMK2 alpha (T286) Recombinant Antibody, AbBy Fluor™ 555 Conjugated
bsm-61319R-BF555-02 100 µL

Phospho-CaMK2 alpha (T286) Recombinant Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
BCL6 Antibody
A40257-100UG 100 µg

BCL6 Antibody

Sign In for Pricing
View Details
Rpp25 (NM_133982) Mouse Recombinant Protein
PM48364M5 20 µg

Rpp25 (NM_133982) Mouse Recombinant Protein

Sign In for Pricing
View Details
Psmf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4295007 1.0 µg DNA

Psmf1 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details