Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H3D protein

This Human HIST1H3D protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l

UniProt

P68431

Expression Region

1-136aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-351AA: 1-136AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KITH_HHV23 rabbit pAb
UB-GEN-12232 100 µL

KITH_HHV23 rabbit pAb

Sign In for Pricing
View Details
Lentiviral human HMGA2 shRNA (UAS) - Lentiviral human HMGA2 shRNA (UAS, GFP) (100)
GTR15323568 1 Vial

Lentiviral human HMGA2 shRNA (UAS) - Lentiviral human HMGA2 shRNA (UAS, GFP) (100)

Sign In for Pricing
View Details
GRIA2 ELISA Kit (Human)
OKEH07722-96W 96 Tests

GRIA2 ELISA Kit (Human)

Sign In for Pricing
View Details
PRKCDBP Polyclonal Antibody
MBS8571872-01 0.1 mL

PRKCDBP Polyclonal Antibody

Sign In for Pricing
View Details
PRKCDBP Polyclonal Antibody
MBS8571872-02 0.1 mL (AF405L)

PRKCDBP Polyclonal Antibody

Sign In for Pricing
View Details
PRKCDBP Polyclonal Antibody
MBS8571872-03 0.1 mL (AF405S)

PRKCDBP Polyclonal Antibody

Sign In for Pricing
View Details