Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human HIST1H3D protein

This Human HIST1H3D protein spans the amino acid sequence from region 1-136aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Histone H3/a Histone H3/b Histone H3/c Histone H3/d Histone H3/f Histone H3/h Histone H3/i Histone H3/j Histone H3/k Histone H3/l

UniProt

P68431

Expression Region

1-136aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Epigenetics & Chromatin

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-351AA: 1-136AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEACEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mycobacterium Smegmatis lexA Protein (aa 1-243)
VAng-Yyj4694-50gEcoli 50 µg (E. coli)

Recombinant Mycobacterium Smegmatis lexA Protein (aa 1-243)

Sign In for Pricing
View Details
ABCB9 Human shRNA Lentiviral Particle (Locus ID 23457)
TL306921V 500 µL Each

ABCB9 Human shRNA Lentiviral Particle (Locus ID 23457)

Sign In for Pricing
View Details
Leucokinin II
FL109979-01 5 mg

Leucokinin II

Sign In for Pricing
View Details
Leucokinin II
FL109979-02 10 mg

Leucokinin II

Sign In for Pricing
View Details
Leucokinin II
FL109979-03 25 mg

Leucokinin II

Sign In for Pricing
View Details
DARC Antibody : Biotin (OAAF04792-Biotin)
OAAF04792-100UG-Biotin 100 µg

DARC Antibody : Biotin (OAAF04792-Biotin)

Sign In for Pricing
View Details