What is the catalog number for Human C16orf80 protein?

The catalog number for Human C16orf80 protein is orb54439.

What sizes are available for Human C16orf80 protein?

Human C16orf80 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human C16orf80 protein come in?

Human C16orf80 protein is available in 3 different pack sizes.

Is Human C16orf80 protein in stock?

Human C16orf80 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human C16orf80 protein

This Human C16orf80 protein spans the amino acid sequence from region 1-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Basal body up-regulated protein 22 Transcription factor IIB

UniProt

Q9Y6A4

Expression Region

1-193aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-163AA: 1-193AAFull Length of BC127719: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ