Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C16orf80 protein

This Human C16orf80 protein spans the amino acid sequence from region 1-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Basal body up-regulated protein 22 Transcription factor IIB

UniProt

Q9Y6A4

Expression Region

1-193aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-163AA: 1-193AAFull Length of BC127719: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

TACE Inhibitor Screening
MA-0388 200 Well

TACE Inhibitor Screening

Sign In for Pricing
View Details
Chicken Amylin ELISA Kit
MBS738428-01 48 Well

Chicken Amylin ELISA Kit

Sign In for Pricing
View Details
Chicken Amylin ELISA Kit
MBS738428-02 96 Well

Chicken Amylin ELISA Kit

Sign In for Pricing
View Details
Chicken Amylin ELISA Kit
MBS738428-03 5x 96 Well

Chicken Amylin ELISA Kit

Sign In for Pricing
View Details
Chicken Amylin ELISA Kit
MBS738428-04 10x 96 Well

Chicken Amylin ELISA Kit

Sign In for Pricing
View Details
SLC35A5 Knockout Cell Lysate
ABC-KC1870 100 µg

SLC35A5 Knockout Cell Lysate

Sign In for Pricing
View Details