Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human C16orf80 protein

This Human C16orf80 protein spans the amino acid sequence from region 1-193aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Basal body up-regulated protein 22 Transcription factor IIB

UniProt

Q9Y6A4

Expression Region

1-193aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

49.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-163AA: 1-193AAFull Length of BC127719: Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFKNTFQSGFLSILYSIGSKPLQIWDKKVRNGHIKRITDNDIQSLVLEIEGTNVSTTYITCPADPKKTLGIKLPFLVMIIKNLKKYFTFEVQVLDDKNVRRRFRASNYQSTTRVKPFICTMPMRLDDGWNQIQFNLLDFTRRAYGTNYIETLRVQIHANCRIRRVYFSDRLYSEDELPAEFKLYLPVQNKAKQ

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Monoclonal 53BP1 Antibody (6B3E10) [Janelia Fluor 635]
NBP2-25028JF635 0.1 mL

Mouse Monoclonal 53BP1 Antibody (6B3E10) [Janelia Fluor 635]

Sign In for Pricing
View Details
Rabbit Polyclonal GPT2 Antibody [Janelia Fluor 549]
NBP3-26095JF549 0.1 mL

Rabbit Polyclonal GPT2 Antibody [Janelia Fluor 549]

Sign In for Pricing
View Details
Monkeypox Virus (strain Zaire-96-I-16) I1L (E.coli), His Tag
E24P015 0.1 mg

Monkeypox Virus (strain Zaire-96-I-16) I1L (E.coli), His Tag

Sign In for Pricing
View Details
Bak recombinant monoclonal antibody
A5068 100ul X 3

Bak recombinant monoclonal antibody

Sign In for Pricing
View Details
Recombinant Rhodobacter capsulatus N (2)-fixation sustaining protein CowN
MBS1209598-01 0.02 mg (E-Coli)

Recombinant Rhodobacter capsulatus N (2)-fixation sustaining protein CowN

Sign In for Pricing
View Details
Recombinant Rhodobacter capsulatus N (2)-fixation sustaining protein CowN
MBS1209598-02 0.1 mg (E-Coli)

Recombinant Rhodobacter capsulatus N (2)-fixation sustaining protein CowN

Sign In for Pricing
View Details