What is the catalog number for Human MARCKSL1 protein?

The catalog number for Human MARCKSL1 protein is orb54433.

What sizes are available for Human MARCKSL1 protein?

Human MARCKSL1 protein is available in the following size(s): 20 µg, 100 µg, 1 mg.

How many pack sizes does Human MARCKSL1 protein come in?

Human MARCKSL1 protein is available in 3 different pack sizes.

Is Human MARCKSL1 protein in stock?

Human MARCKSL1 protein is currently made to order / not held in immediate stock. Contact us for lead time.

Human MARCKSL1 protein

This Human MARCKSL1 protein spans the amino acid sequence from region 1-195aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MARCKS-like protein 1 Macrophage myristoylated alanine-rich C kinase substrate

UniProt

P49006

Expression Region

1-195aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal 6xHis-SUMO-tagged and C-terminal Myc-tagged: N-terminal GST-tagged1-307AA: 1-195AAFull Length of Isoform 2 : Full Length of BC066915

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MGSQSSKAPRGDVTAEEAAGASPAKANGQENGHVKSNGDLSPKGEGESPPVNGTDEAAGATGDAIEPAPTSQGAEAKGEVPPKETPKKKKKFSFKKPFKLSGLSFKRNRKEGGGDSSASSPTEEEQEQGEIGACSDEGTAQEGKAAATPESQEPQAKGAEASAASEEEAGPQATEPSTPSGPESGPTPASAEQNE