Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ISCU protein

Recombinant human ISCU protein

Product Specifications

Product Name Alternative

NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN)

UniProt

Q9H1K1

Expression Region

35-167aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-308AA: 1-167AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RASEF (Ras and EF-hand Domain-containing Protein, Ras-related Protein Rab-45, RAB45) (HRP)
132339-HRP 100 µL

RASEF (Ras and EF-hand Domain-containing Protein, Ras-related Protein Rab-45, RAB45) (HRP)

Sign In for Pricing
View Details
IFT81 3'UTR Luciferase Stable Cell Line
TU010511 1.0 mL

IFT81 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
Phospho-c-Abl (Tyr272) Rabbit Polyclonal Antibody (HRP)
orb504228 100 µL

Phospho-c-Abl (Tyr272) Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
Zc3h14 ORF Vector (Mouse) (pORF)
ORF062113 1.0 µg DNA

Zc3h14 ORF Vector (Mouse) (pORF)

Sign In for Pricing
View Details
Anti-eNOS/NOS3 Antibody Picoband® Fluoro488 Conjugated
A01604-2-Fluoro488 100 µg/Vial

Anti-eNOS/NOS3 Antibody Picoband® Fluoro488 Conjugated

Sign In for Pricing
View Details
STAT3 Protein Vector (Rat) (pPM-C-HA)
PV308492 500 ng

STAT3 Protein Vector (Rat) (pPM-C-HA)

Sign In for Pricing
View Details