Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human ISCU protein

Recombinant human ISCU protein

Product Specifications

Product Name Alternative

NifU-like N-terminal domain-containing protein (NifU-like protein) (NIFUN)

UniProt

Q9H1K1

Expression Region

35-167aa

Tag

N-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-308AA: 1-167AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Mouse IGHE Protein, N-His
YHJ92701 100 μg

Recombinant Mouse IGHE Protein, N-His

Sign In for Pricing
View Details
Lentiviral human C8orf89 shRNA (UAS) - Lentiviral human C8orf89 shRNA (UAS) plasmid
GTR15085207 1 Vial

Lentiviral human C8orf89 shRNA (UAS) - Lentiviral human C8orf89 shRNA (UAS) plasmid

Sign In for Pricing
View Details
Recombinant Human PCK2 Protein (His & GST Tag)
ARP8447-01 10 µg

Recombinant Human PCK2 Protein (His & GST Tag)

Sign In for Pricing
View Details
Recombinant Human PCK2 Protein (His & GST Tag)
ARP8447-02 50 µg

Recombinant Human PCK2 Protein (His & GST Tag)

Sign In for Pricing
View Details
Recombinant Human PCK2 Protein (His & GST Tag)
ARP8447-03 100 µg

Recombinant Human PCK2 Protein (His & GST Tag)

Sign In for Pricing
View Details
Recombinant Human PCK2 Protein (His & GST Tag)
ARP8447-04 1 mg

Recombinant Human PCK2 Protein (His & GST Tag)

Sign In for Pricing
View Details