Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human RP2 protein

This Human RP2 protein spans the amino acid sequence from region 1-350aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

RP2, Protein XRP2

UniProt

O75695

Expression Region

1-350aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

66.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-368AA: 1-350AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GCFFSKRRKADKESRPENEEERPKQYSWDQREKVDPKDYMFSGLKDETVGRLPGTVAGQQFLIQDCENCNIYIFDHSATVTIDDCTNCIIFLGPVKGSVFFRNCRDCKCTLACQQFRVRDCRKLEVFLCCATQPIIESSSNIKFGCFQWYYPELAFQFKDAGLSIFNNTWSNIHDFTPVSGELNWSLLPEDAVVQDYVPIPTTEELKAVRVSTEANRSIVPISRGQRQKSSDESCLVVLFAGDYTIANARKLIDEMVGKGFFLVQTKEVSMKAEDAQRVFREKAPDFLPLLNKGPVIALEFNGDGAVEVCQLIVNEIFNGTKMFVSESKETASGDVDSFYNFADIQMGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Vasodilator Stimulated Phosphoprotein, phosphorylated (VASP) (Ser239)
V2118 100 µg

Vasodilator Stimulated Phosphoprotein, phosphorylated (VASP) (Ser239)

Sign In for Pricing
View Details
PPARA Antibody
orb1335793 100 µg

PPARA Antibody

Sign In for Pricing
View Details
Mant-ADP, S pack
JBS-NU-201S 150 μL

Mant-ADP, S pack

Sign In for Pricing
View Details
DAZAP1 Protein Vector (Mouse) (pPB-N-His)
PV170515 500 ng

DAZAP1 Protein Vector (Mouse) (pPB-N-His)

Sign In for Pricing
View Details
Anti-Galectin 3 Antibody
MBS8323973-01 0.03 mL

Anti-Galectin 3 Antibody

Sign In for Pricing
View Details
Anti-Galectin 3 Antibody
MBS8323973-02 0.05 mL

Anti-Galectin 3 Antibody

Sign In for Pricing
View Details