Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NNMT protein

This Human NNMT protein spans the amino acid sequence from region 1-264aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EC 2.1.1.1, Nicotinamide N methyltransferase, Nicotinamide N-methyltransferase, NNMT, NNMT_HUMAN

UniProt

P40261

Expression Region

1-264aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-279AA: 1-264AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

NDUFV2 Antibody
E38PA1792 100 µL

NDUFV2 Antibody

Sign In for Pricing
View Details
P4HB Mouse mAb
E2222581 100 µL

P4HB Mouse mAb

Sign In for Pricing
View Details
LC3B Antibody [G7J7]
C18612-50uL 50 μL

LC3B Antibody [G7J7]

Sign In for Pricing
View Details
IFNA1 (Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA13, MGC138207, MGC138505, MGC138507)
128262 100 µg

IFNA1 (Interferon alpha-1/13, IFN-alpha-1/13, Interferon alpha-D, LeIF D, IFNA13, MGC138207, MGC138505, MGC138507)

Sign In for Pricing
View Details
PPP1R3C Rabbit Polyclonal Antibody (HRP)
orb3128529 100 µg

PPP1R3C Rabbit Polyclonal Antibody (HRP)

Sign In for Pricing
View Details
GGT1/2 (A-4) : m-IgGκ BP-HRP Bundle
sc-524054 1 Kit

GGT1/2 (A-4) : m-IgGκ BP-HRP Bundle

Sign In for Pricing
View Details