Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human NNMT protein

This Human NNMT protein spans the amino acid sequence from region 1-264aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EC 2.1.1.1, Nicotinamide N methyltransferase, Nicotinamide N-methyltransferase, NNMT, NNMT_HUMAN

UniProt

P40261

Expression Region

1-264aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Signal Transduction

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-279AA: 1-264AAFull Length : Full Length

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MESGFTSKDTYLSHFNPRDYLEKYYKFGSRHSAESQILKHLLKNLFKIFCLDGVKGDLLIDIGSGPTIYQLLSACESFKEIVVTDYSDQNLQELEKWLKKEPEAFDWSPVVTYVCDLEGNRVKGPEKEEKLRQAVKQVLKCDVTQSQPLGAVPLPPADCVLSTLCLDAACPDLPTYCRALRNLGSLLKPGGFLVIMDALKSSYYMIGEQKFSSLPLGREAVEAAVKEAGYTIEWFEVISQSYSSTMANNEGLFSLVARKLSRPL

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Guinea-pig MSMβ (Microseminoprotein Beta) ValidElisa Kit
EK347949 96 Well

Guinea-pig MSMβ (Microseminoprotein Beta) ValidElisa Kit

Sign In for Pricing
View Details
MAOA Antibody
OACD05406-1ML 1 mL

MAOA Antibody

Sign In for Pricing
View Details
FGFR4 Antibody Blocking peptide
orb1446187 500 µg

FGFR4 Antibody Blocking peptide

Sign In for Pricing
View Details
FMDV VP1 protein (type O) Rabbit pAb, IRDye 800CW conjugated
orb2822731 100 µL

FMDV VP1 protein (type O) Rabbit pAb, IRDye 800CW conjugated

Sign In for Pricing
View Details
Recombinant Pseudomonas Aeruginosa bioD Protein (aa 1-228) (strain PA7)
VAng-Cr0452-500gEcoli 500 µg (E. coli)

Recombinant Pseudomonas Aeruginosa bioD Protein (aa 1-228) (strain PA7)

Sign In for Pricing
View Details
GPRIN2 Rabbit Polyclonal Antibody (BF555)
orb2385226 100 µL

GPRIN2 Rabbit Polyclonal Antibody (BF555)

Sign In for Pricing
View Details