Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF14 protein

This Human FGF14 protein spans the amino acid sequence from region 1-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor homologous factor 4

UniProt

Q92915

Expression Region

1-252aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-368AA: 1-252AAFull Length of Isoform 2 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TRIM63 Conjugated Antibody
orb1619763 100 µL

TRIM63 Conjugated Antibody

Sign In for Pricing
View Details
Histone H2B Mouse Monoclonal Antibody (Cy5.5)
orb1082438 100 µL

Histone H2B Mouse Monoclonal Antibody (Cy5.5)

Sign In for Pricing
View Details
Mouse TMCO1 siRNA
abx936977-01 15 nmol

Mouse TMCO1 siRNA

Sign In for Pricing
View Details
Mouse TMCO1 siRNA
abx936977-02 30 nmol

Mouse TMCO1 siRNA

Sign In for Pricing
View Details
Lentiviral mouse Defb28 shRNA (UAS) - Lentiviral mouse Defb28 shRNA (UAS, iRFP) (100)
GTR15199263 1 Vial

Lentiviral mouse Defb28 shRNA (UAS) - Lentiviral mouse Defb28 shRNA (UAS, iRFP) (100)

Sign In for Pricing
View Details
HRP-Linked Polyclonal Antibody to Macrophage Stimulating 1 Receptor (MST1R)
MBS2056196-01 0.1 mL

HRP-Linked Polyclonal Antibody to Macrophage Stimulating 1 Receptor (MST1R)

Sign In for Pricing
View Details