Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Human FGF14 protein

This Human FGF14 protein spans the amino acid sequence from region 1-252aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Fibroblast growth factor homologous factor 4

UniProt

Q92915

Expression Region

1-252aa

Tag

N-terminal GST-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

55.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

N-terminal GST-tagged: N-terminal GST-tagged1-368AA: 1-252AAFull Length of Isoform 2 : Full Length of Isoform 2

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MVKPVPLFRRTDFKLLLCNHKDLFFLRVSKLLDCFSPKSMWFLWNIFSKGTHMLQCLCGKSLKKNKNPTDPQLKGIVTRLYCRQGYYLQMHPDGALDGTKDDSTNSTLFNLIPVGLRVVAIQGVKTGLYIAMNGEGYLYPSELFTPECKFKESVFENYYVIYSSMLYRQQESGRAWFLGLNKEGQAMKGNRVKKTKPAAHFLPKPLEVAMYREPSLHDVGETVPKPGVTPSKSTSASAIMNGGKPVNKSKTT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SPP1 Western Blot Kit
GWB-4172CB 1 Kit

SPP1 Western Blot Kit

Sign In for Pricing
View Details
Mouse monoclonal BTLA/CD272 Antibody (OTI2E4)
NBP2-45549 0.1 mL

Mouse monoclonal BTLA/CD272 Antibody (OTI2E4)

Sign In for Pricing
View Details
Anti-METAP1 Antibody
CQA9316-01 30 µL

Anti-METAP1 Antibody

Sign In for Pricing
View Details
Anti-METAP1 Antibody
CQA9316-02 50 μL

Anti-METAP1 Antibody

Sign In for Pricing
View Details
Anti-METAP1 Antibody
CQA9316-03 100 µL

Anti-METAP1 Antibody

Sign In for Pricing
View Details
Anti-METAP1 Antibody
CQA9316-04 200 µL

Anti-METAP1 Antibody

Sign In for Pricing
View Details